PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000021.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family BES1
Protein Properties Length: 323aa    MW: 34709.8 Da    PI: 8.4762
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000021.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822213.26.5e-66271562132
                   DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssas 87 
                              +++rkp+w+ErEnn+rRERrRRaiaakiy+GLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp   +e++g+sa+
  Itr_sc000021.1_g00004.1  27 SGRRKPSWRERENNRRRERRRRAIAAKIYSGLRAQGNYNLPKHCDNNEVLKALCTEAGWIVEPDGTTYRKGCKPI-PMEIGGTSAN 111
                              799************************************************************************.********** PP

                   DUF822  88 aspesslqsslkssalaspvesysaspksssfpspssldsislas 132
                              ++p+ss + s+ ss++asp++sy+asp ss+ psp++ d + + +
  Itr_sc000021.1_g00004.1 112 ITPSSSRHPSPPSSYFASPIPSYQASPLSSACPSPTRGDANISPH 156
                              *************************************99986553 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.7E-6127154IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MMWEGGGSAA SLSGGGGEGG VGGGSSSGRR KPSWRERENN RRRERRRRAI AAKIYSGLRA  60
QGNYNLPKHC DNNEVLKALC TEAGWIVEPD GTTYRKGCKP IPMEIGGTSA NITPSSSRHP  120
SPPSSYFASP IPSYQASPLS SACPSPTRGD ANISPHPFVF LHNSIPSSLP ALRISNSAPV  180
TPPLSSPTRV PKQTFNLEAL AKDSMSAFNI SFFASAPTSP TRGHRFPATI PECDESDTST  240
IDSGQWMSFQ KYAPSVVPTS PTFNLMKPVA QQIPSSDAMF TEDGKSMEFD FEKVAMKAWE  300
GERIHEVGLD DLELTLGSGN ARS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12847RRKPSWRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.11e-156PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-119BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLK4BV771e-152K4BV77_SOLLC; Uncharacterized protein
STRINGSolyc04g079980.2.11e-152(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.21e-115BES1 family protein